Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana HVA22-like protein e (HVA22E)

This Recombinant Arabidopsis thaliana HVA22-like protein e (HVA22E) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

HVA22-like protein e, AtHVA22e

UniProt

Q9FED2

Expression Region

1-116

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLWTSLSALHSLAGPVVMLLYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELIL QSLLEWIPIWYTAKLVFVAWLVLPQFRGAAFIYNKVVREQFKKYGILKPKVEHQAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF594 conjugate, 0.1mg/mL
BNC942034-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL
BNC472843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL
BNC942939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF568 conjugate, 0.1mg/mL
BNC681120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF405S conjugate, 0.1mg/mL
BNC040841-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details