Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q9RPY2

Expression Region

1-116

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BFSP1 Protein Lysate
MBS137945-01 0.02 mg

Human BFSP1 Protein Lysate

Sign In for Pricing
View Details
Human BFSP1 Protein Lysate
MBS137945-02 5x 0.02 mg

Human BFSP1 Protein Lysate

Sign In for Pricing
View Details
RPUSD3 (C-2) P
sc-393209 P 100 µg - 0.5 mL

RPUSD3 (C-2) P

Sign In for Pricing
View Details
ZNF560 Antibody
MBS9430510-01 0.1 mL

ZNF560 Antibody

Sign In for Pricing
View Details
ZNF560 Antibody
MBS9430510-02 5x 0.1 mL

ZNF560 Antibody

Sign In for Pricing
View Details
(Ripertamab) Biosimilar Reference Antibody
orb3158883-01 100 µg

(Ripertamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details