Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q9RPY2

Expression Region

1-116

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Sulfatide ELISA Kit
GTR10323982 96 Well

Bovine Sulfatide ELISA Kit

Sign In for Pricing
View Details
1-Pentane Sulphonic Acid Sodium SaL Anhydrous 99% AR/HPLC
194500025 25 mg

1-Pentane Sulphonic Acid Sodium SaL Anhydrous 99% AR/HPLC

Sign In for Pricing
View Details
Rrbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4627507 1.0 µg DNA

Rrbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human RPL41 Protein - (Dry Ice)
H00006171-P01-10ug 10 µg

Recombinant Human RPL41 Protein - (Dry Ice)

Sign In for Pricing
View Details
CD33 Rabbit pAb
APA1604-01 30 µL

CD33 Rabbit pAb

Sign In for Pricing
View Details
CD33 Rabbit pAb
APA1604-02 50 μL

CD33 Rabbit pAb

Sign In for Pricing
View Details