Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q9RPY2

Expression Region

1-116

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haptoglobin Beta Chain (HP) Antibody
abx432819 200 µL

Haptoglobin Beta Chain (HP) Antibody

Sign In for Pricing
View Details
Katanin p80 BL1 CRISPR Activation Plasmid (h2)
sc-417863-ACT-2 20 µg

Katanin p80 BL1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (MaxLight 550)
134780-ML550 100 µL

TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (MaxLight 550)

Sign In for Pricing
View Details
7-Bromo-5-fluoro-1,3-benzoxazole
BZB04594-01 100 mg

7-Bromo-5-fluoro-1,3-benzoxazole

Sign In for Pricing
View Details
7-Bromo-5-fluoro-1,3-benzoxazole
BZB04594-02 1 g

7-Bromo-5-fluoro-1,3-benzoxazole

Sign In for Pricing
View Details
OPLAH Antibody - C-terminal region
MBS3218690-01 0.1 mL

OPLAH Antibody - C-terminal region

Sign In for Pricing
View Details