Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P94185

Expression Region

1-116

Origin

Alcaligenes sp.

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALV ALFFAWRRIYRPAQACKPGEVCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (HMB45), CF647 conjugate, 0.1mg/mL
BNC470444-500 1x 500 µL

Pmel17 / gp100 / SILV (HMB45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Two Component PCR Plates
P9096-HSC 50 Units/Pack

Two Component PCR Plates

Sign In for Pricing
View Details
IQGAP1 Rabbit Polyclonal Antibody
TA377550 100 µL

IQGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGR4 (NM_001965) Human Over-expression Lysate
LC432313 20 µg

EGR4 (NM_001965) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A4 Recombinant Rabbit Monoclonal Antibody [SD200-08]
ET1612-13 100 µL

S100A4 Recombinant Rabbit Monoclonal Antibody [SD200-08]

Sign In for Pricing
View Details
Psmd4 Mouse Gene Knockout Kit (CRISPR)
KN514123 1 Kit

Psmd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details