Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

P0C526

Expression Region

1-116

Origin

Brucella abortus biovar 1 (strain 9-941)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX14 siRNA Oligos set (Human)
45137171 3x 5 nmol

SOX14 siRNA Oligos set (Human)

Sign In for Pricing
View Details
[KO Validated] CD2BP2 Rabbit pAb
MBS9144486-01 0.02 mL

[KO Validated] CD2BP2 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] CD2BP2 Rabbit pAb
MBS9144486-02 0.05 mL

[KO Validated] CD2BP2 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] CD2BP2 Rabbit pAb
MBS9144486-03 0.1 mL

[KO Validated] CD2BP2 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] CD2BP2 Rabbit pAb
MBS9144486-04 0.2 mL

[KO Validated] CD2BP2 Rabbit pAb

Sign In for Pricing
View Details
[KO Validated] CD2BP2 Rabbit pAb
MBS9144486-05 5x 0.2 mL

[KO Validated] CD2BP2 Rabbit pAb

Sign In for Pricing
View Details