Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB3 (virB3)

This Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

P0C526

Expression Region

1-116

Origin

Brucella abortus biovar 1 (strain 9-941)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRCH3 Antibody
MBS859847-01 0.1 mg

LRCH3 Antibody

Sign In for Pricing
View Details
LRCH3 Antibody
MBS859847-02 0.1 mL (AF405L)

LRCH3 Antibody

Sign In for Pricing
View Details
LRCH3 Antibody
MBS859847-03 0.1 mL (AF405S)

LRCH3 Antibody

Sign In for Pricing
View Details
LRCH3 Antibody
MBS859847-04 0.1 mL (AF610)

LRCH3 Antibody

Sign In for Pricing
View Details
LRCH3 Antibody
MBS859847-05 0.1 mL (AF635)

LRCH3 Antibody

Sign In for Pricing
View Details
LRCH3 Antibody
MBS859847-06 0.1 mL (APC)

LRCH3 Antibody

Sign In for Pricing
View Details