Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1D, LHCII type I CAB-1D, LHCP

UniProt

P10707

Expression Region

1-116

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-43 + DC10), CF488A conjugate, 0.1mg/mL
BNC880770-100 1x 100 µL

Cytokeratin 8/18 (C-43 + DC10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (CCNA2) (NM_001237) Human Recombinant Protein
TP311148M 100 µg

Cyclin A2 (CCNA2) (NM_001237) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant TUBG1 Antibody
RC-5722-01 50 μL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Recombinant TUBG1 Antibody
RC-5722-02 100 µL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Recombinant TUBG1 Antibody
RC-5722-03 1 mL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse TSLP Receptor/CRLF2 Protein (Fc Tag)
PKSM041158-01 10 µg

Recombinant Mouse TSLP Receptor/CRLF2 Protein (Fc Tag)

Sign In for Pricing
View Details