Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1D, LHCII type I CAB-1D, LHCP

UniProt

P10707

Expression Region

1-116

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 (21-145) Mouse Monoclonal Antibody [Clone ID: 5C10]
AM03178PU-T 50 µL

CD44 (21-145) Mouse Monoclonal Antibody [Clone ID: 5C10]

Sign In for Pricing
View Details
CF®680 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20931-50uL 1x 50 µL

CF®680 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]
TA504764BM 100 µL

Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]

Sign In for Pricing
View Details
Csn1s2b (NM_009973) Mouse Tagged ORF Clone
MG200935 10 µg

Csn1s2b (NM_009973) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Myostatin Propeptide (MSTN) Chicken Polyclonal Antibody
AP02127PU-N 100 µg

Myostatin Propeptide (MSTN) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA369017 100 µL

CARD12 (NLRC4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details