Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Rv3760 (Rv3760)

This Recombinant Uncharacterized membrane protein Rv3760 (Rv3760) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Rv3760

UniProt

O69726

Expression Region

1-117

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNPSSSADQPLSGTTVPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQ NTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783F-01 25 µg

PerCP Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PerCP Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783F-02 100 µg

PerCP Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Human ZNF703 activation kit by CRISPRa
GA112831 1 Kit

Human ZNF703 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 0.2mg/mL
BNUB1948-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 0.2mg/mL

Sign In for Pricing
View Details
SIGLEC15 (NM_213602) Human Recombinant Protein
TP701064 50 µg

SIGLEC15 (NM_213602) Human Recombinant Protein

Sign In for Pricing
View Details
TMIE (NM_147196) Human Recombinant Protein
TP320050 20 µg

TMIE (NM_147196) Human Recombinant Protein

Sign In for Pricing
View Details