Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Rv3760 (Rv3760)

This Recombinant Uncharacterized membrane protein Rv3760 (Rv3760) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Rv3760

UniProt

O69726

Expression Region

1-117

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNPSSSADQPLSGTTVPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQ NTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r193 Mouse Gene Knockout Kit (CRISPR)
KN518984 1 Kit

Vmn1r193 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P97 MAPK Antibody
8C11136-AAT 50 µg

P97 MAPK Antibody

Sign In for Pricing
View Details
1-Decyne
TRC-D228478-50MG 50 mg

1-Decyne

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS643223 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF543 conjugate, 0.1mg/mL
BNC432501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF640R conjugate, 0.1mg/mL
BNC402426-100 1x 100 µL

ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details