Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Rv3760 (Rv3760)

This Recombinant Uncharacterized membrane protein Rv3760 (Rv3760) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Rv3760

UniProt

O69726

Expression Region

1-117

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNPSSSADQPLSGTTVPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQ NTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate
LY433176 100 µg

SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate

Sign In for Pricing
View Details
Sambucus Nigra Lectin (SNA, EBL), Biotin Conjugate
#29120 1x 1 mL

Sambucus Nigra Lectin (SNA, EBL), Biotin Conjugate

Sign In for Pricing
View Details
RPL13AP17 (NM_203308) Human Over-expression Lysate
LC404390 20 µg

RPL13AP17 (NM_203308) Human Over-expression Lysate

Sign In for Pricing
View Details
(±)-Rolipram
TRC-R640040-10MG 10 mg

(±)-Rolipram

Sign In for Pricing
View Details
KAT8 Rabbit Monoclonal Antibody
TA423656 100 µL

KAT8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS500863 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details