Recombinant Lysinibacillus sphaericus UPF0295 protein Bsph_0336 (Bsph_0336)
This Recombinant Lysinibacillus sphaericus UPF0295 protein Bsph_0336 (Bsph_0336) spans the amino acid sequence from region 1-117.
Product Specifications
Product Name Alternative
UPF0295 protein Bsph_0336
UniProt
B1HUT5
Expression Region
1-117
Origin
Lysinibacillus sphaericus (strain C3-41)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMTLGVLCIIGSTVVYAWI GLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLEGKEFDQSYNHKTKKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
