Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 207 (TMEM207)

This Recombinant Human Transmembrane protein 207 (TMEM207) spans the amino acid sequence from region 30-146.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

Q6UWW9

Expression Region

30-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTM AVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41 Recombinant Rabbit monoclonal Antibody
HA751201 100 µL

CD41 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TAS2R45 Human Gene Knockout Kit (CRISPR)
KN422294 1 Kit

TAS2R45 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Clec2d Mouse Gene Knockout Kit (CRISPR)
KN503435 1 Kit

Clec2d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Stanniocalcin 2 (STC2) activation kit by CRISPRa
GA105703 1 Kit

Human Stanniocalcin 2 (STC2) activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-
F-4601-5 5 mg

FITC Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-

Sign In for Pricing
View Details
USP16 (NM_006447) Human Recombinant Protein
TP322609L 1 mg

USP16 (NM_006447) Human Recombinant Protein

Sign In for Pricing
View Details