Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 207 (TMEM207)

This Recombinant Human Transmembrane protein 207 (TMEM207) spans the amino acid sequence from region 30-146.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

Q6UWW9

Expression Region

30-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTM AVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuropeptide Y Recombinant Rabbit monoclonal Antibody
HA723886 100 µL

Neuropeptide Y Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human GLUT12 (SLC2A12) activation kit by CRISPRa
GA115884 1 Kit

Human GLUT12 (SLC2A12) activation kit by CRISPRa

Sign In for Pricing
View Details
beta Catenin (CTNNB1) pThr41/pSer45 Rabbit Polyclonal Antibody
AP01543PU-N 100 µg

beta Catenin (CTNNB1) pThr41/pSer45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF640R conjugate, 0.1mg/mL
BNC402399-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JMJD5 (KDM8) (N-term) Rabbit Polyclonal Antibody
AP52273PU-N 400 µL

JMJD5 (KDM8) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Benzyl Salbutamon Hydrochloride
TRC-B289000-250MG 250 mg

N-Benzyl Salbutamon Hydrochloride

Sign In for Pricing
View Details