Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 207 (TMEM207)

This Recombinant Human Transmembrane protein 207 (TMEM207) spans the amino acid sequence from region 30-146.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

Q6UWW9

Expression Region

30-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTM AVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
AP02558PU-N 100 µL

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(tert-Butyl)-4-nitrophenol
TRC-B814368-50MG 50 mg

2-(tert-Butyl)-4-nitrophenol

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR562141 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
CYP27B1 Human Gene Knockout Kit (CRISPR)
KN422840 1 Kit

CYP27B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FASTK Rabbit Polyclonal Antibody
TA360843 100 µL

FASTK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Doublecortin Recombinant Chimeric Antibody Antibody
HA610325 100 µL

Doublecortin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details