Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reprimo-like protein (Rprml)

This Recombinant Mouse Reprimo-like protein (Rprml) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q3URD2

Expression Region

1-117

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSFLNHSGLEEVGGDARATLGNRSHGLGTWLDCCPGGAPLTASDGVPAGLAPDERSLW VSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLMQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ing5 Rat shRNA Lentiviral Particle (Locus ID 363292)
TL707339V 500 µL Each

Ing5 Rat shRNA Lentiviral Particle (Locus ID 363292)

Sign In for Pricing
View Details
Anti-ABI2 Antibody Picoband®, Cy3 Conjugate
A04302-Cy3 100 µg/Vial

Anti-ABI2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Ahcyl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6432906 1.0 µg DNA

Ahcyl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Prdm12 Mouse shRNA Plasmid (Locus ID 381359)
TL518753 1 Kit

Prdm12 Mouse shRNA Plasmid (Locus ID 381359)

Sign In for Pricing
View Details
Fish Alkaline Phosphatase, ALP GENLISA ELISA
KLF0029 96 Well

Fish Alkaline Phosphatase, ALP GENLISA ELISA

Sign In for Pricing
View Details
Mouse Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit
RDR-NR3C1-Mu-48Tests 48 Tests

Mouse Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit

Sign In for Pricing
View Details