Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reprimo-like protein (Rprml)

This Recombinant Mouse Reprimo-like protein (Rprml) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q3URD2

Expression Region

1-117

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSFLNHSGLEEVGGDARATLGNRSHGLGTWLDCCPGGAPLTASDGVPAGLAPDERSLW VSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLMQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 beta (HRP)
MBS6250703-01 0.1 mL

CD8 beta (HRP)

Sign In for Pricing
View Details
CD8 beta (HRP)
MBS6250703-02 5x 0.1 mL

CD8 beta (HRP)

Sign In for Pricing
View Details
Lentiviral human SELE shRNA (UAS) - Lentiviral human SELE shRNA (UAS) (25)
GTR15340652 1 Vial

Lentiviral human SELE shRNA (UAS) - Lentiviral human SELE shRNA (UAS) (25)

Sign In for Pricing
View Details
Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)
PT_40777-01 10 µg

Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)

Sign In for Pricing
View Details
Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)
PT_40777-02 50 µg

Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)

Sign In for Pricing
View Details
Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)
PT_40777-03 1 mg

Glutathione S-Transferase M1 Mouse Recombinant (GSTM1 Mouse)

Sign In for Pricing
View Details