Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reprimo-like protein (Rprml)

This Recombinant Mouse Reprimo-like protein (Rprml) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q3URD2

Expression Region

1-117

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVSFLNHSGLEEVGGDARATLGNRSHGLGTWLDCCPGGAPLTASDGVPAGLAPDERSLW VSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLMQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2 alpha antibody
20R-2427 0.05 mg

EIF2 alpha antibody

Sign In for Pricing
View Details
Rabbit anti Human IgM (mu chain) (rhodamine)
43R-1279 1 mg

Rabbit anti Human IgM (mu chain) (rhodamine)

Sign In for Pricing
View Details
Prr11 Mouse shRNA Plasmid (Locus ID 270906)
TL510231 1 Kit

Prr11 Mouse shRNA Plasmid (Locus ID 270906)

Sign In for Pricing
View Details
1-Ethyl-3- (3-hydroxypropyl) urea
ZHA10680-01 250 mg

1-Ethyl-3- (3-hydroxypropyl) urea

Sign In for Pricing
View Details
1-Ethyl-3- (3-hydroxypropyl) urea
ZHA10680-02 2.5 g

1-Ethyl-3- (3-hydroxypropyl) urea

Sign In for Pricing
View Details
Recombinant Human PC4 and SFRS1-interacting protein Protein, His-SUMO, E.coli-100ug
QP6542-ec-100ug 100ug

Recombinant Human PC4 and SFRS1-interacting protein Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details