Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q49XE2

Expression Region

1-117

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAVAVVMGAAFNKIVTALVSYIIMPLIGLIFGTVDFAESWSFMG IKYGMFVQSIIDFIIIAFALFIFVKIANTLMKKEEEEEIEENTVLLTEIRDLLREKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Helix aspersa Lectin (Garden Snail) -HAA-
T-3801-1 1 mg

Texas Red Conjugated Helix aspersa Lectin (Garden Snail) -HAA-

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF488A conjugate, 0.1mg/mL
BNC882894-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Florfenicol-d3
TRC-F405751-1MG 1 mg

Florfenicol-d3

Sign In for Pricing
View Details
(1R,6R)-2,8-Diazabicyclo[4.3.0]nonane (Technical Grade)
TRC-D417275-25MG 25 mg

(1R,6R)-2,8-Diazabicyclo[4.3.0]nonane (Technical Grade)

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
E-AB-90065-01 60 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
E-AB-90065-02 120 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details