Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q49XE2

Expression Region

1-117

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAVAVVMGAAFNKIVTALVSYIIMPLIGLIFGTVDFAESWSFMG IKYGMFVQSIIDFIIIAFALFIFVKIANTLMKKEEEEEIEENTVLLTEIRDLLREKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CANX Antibody - middle region
ARP82133_P050-25UL 25 µL

CANX Antibody - middle region

Sign In for Pricing
View Details
pCMV-SPORT6-MORN4 Plasmid
PVT16838 2 µg

pCMV-SPORT6-MORN4 Plasmid

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS603919 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
NPR2 (Atrial Natriuretic Peptide Receptor 2, Atrial Natriuretic Peptide Receptor Type B, ANP-B, ANPR-B, NPR-B, Guanylate Cyclase B, GC-B, ANPRB) (Biotin)
MBS6143239-01 0.1 mL

NPR2 (Atrial Natriuretic Peptide Receptor 2, Atrial Natriuretic Peptide Receptor Type B, ANP-B, ANPR-B, NPR-B, Guanylate Cyclase B, GC-B, ANPRB) (Biotin)

Sign In for Pricing
View Details
NPR2 (Atrial Natriuretic Peptide Receptor 2, Atrial Natriuretic Peptide Receptor Type B, ANP-B, ANPR-B, NPR-B, Guanylate Cyclase B, GC-B, ANPRB) (Biotin)
MBS6143239-02 5x 0.1 mL

NPR2 (Atrial Natriuretic Peptide Receptor 2, Atrial Natriuretic Peptide Receptor Type B, ANP-B, ANPR-B, NPR-B, Guanylate Cyclase B, GC-B, ANPRB) (Biotin)

Sign In for Pricing
View Details
Anti-IP3 receptor/ITPR1 Antibody
PA2270 100 µg/Vial

Anti-IP3 receptor/ITPR1 Antibody

Sign In for Pricing
View Details