Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q49XE2

Expression Region

1-117

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAVAVVMGAAFNKIVTALVSYIIMPLIGLIFGTVDFAESWSFMG IKYGMFVQSIIDFIIIAFALFIFVKIANTLMKKEEEEEIEENTVLLTEIRDLLREKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLKL antibody
70R-4173 100 µL

MLKL antibody

Sign In for Pricing
View Details
3- (2-Chloro-6-nitrophenyl) propanoic acid
FJC99768-01 50 mg

3- (2-Chloro-6-nitrophenyl) propanoic acid

Sign In for Pricing
View Details
3- (2-Chloro-6-nitrophenyl) propanoic acid
FJC99768-02 0.5 g

3- (2-Chloro-6-nitrophenyl) propanoic acid

Sign In for Pricing
View Details
TMEM88B Protein Vector (Rat) (pPB-C-His)
PV311850 500 ng

TMEM88B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Nr1h4 (NM_001163700) Mouse Tagged ORF Clone
MR227500 10 µg

Nr1h4 (NM_001163700) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Beta-catenin Mouse Monoclonal Antibody
orb323105-01 30 µL

Beta-catenin Mouse Monoclonal Antibody

Sign In for Pricing
View Details