Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus haemolyticus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q4L656

Expression Region

1-117

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIVTSLVTYIIMPLIGKIFGSVDFAKDWEFWG IKYGLFIQSIIDFIIVAIALFIFVKIANTLVKKEEPEEEIEENTVLLTEIRDLLRAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E47P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1536005 3x 1.0 µg

OR7E47P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Galectin-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-10629R-BF488 100 µL

Galectin-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
PARP1 Antibody / Poly ADP-ribose polymerase 1
FY13012 100 µg

PARP1 Antibody / Poly ADP-ribose polymerase 1

Sign In for Pricing
View Details
RBM41 (NM_018301) Human Recombinant Protein
PH40749M5 20 µg

RBM41 (NM_018301) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rat Anionic trypsin-1
MBS953496-01 0.02 mg (E-Coli)

Recombinant Rat Anionic trypsin-1

Sign In for Pricing
View Details
Recombinant Rat Anionic trypsin-1
MBS953496-02 0.02 mg (Yeast)

Recombinant Rat Anionic trypsin-1

Sign In for Pricing
View Details