Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0295 protein ygzB (ygzB)

This Recombinant Bacillus subtilis UPF0295 protein ygzB (ygzB) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

UPF0295 protein ygzB

UniProt

Q7WY74

Expression Region

1-117

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWI GMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Daprodustat
TRC-D193368-25MG 25 mg

Daprodustat

Sign In for Pricing
View Details
PAK2 Rabbit pAb
MBS8543602-01 0.1 mL

PAK2 Rabbit pAb

Sign In for Pricing
View Details
PAK2 Rabbit pAb
MBS8543602-02 0.1 mL (AF405L)

PAK2 Rabbit pAb

Sign In for Pricing
View Details
PAK2 Rabbit pAb
MBS8543602-03 0.1 mL (AF405S)

PAK2 Rabbit pAb

Sign In for Pricing
View Details
PAK2 Rabbit pAb
MBS8543602-04 0.1 mL (AF610)

PAK2 Rabbit pAb

Sign In for Pricing
View Details
PAK2 Rabbit pAb
MBS8543602-05 0.1 mL (AF635)

PAK2 Rabbit pAb

Sign In for Pricing
View Details