Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165)

This Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C14orf165

UniProt

Q86U02

Expression Region

1-117

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQT GVHWCNLGSLQPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Phosphoribosylformylglycinamidine synthase 2 (purL), partial
MBS1468020 Inquire

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Phosphoribosylformylglycinamidine synthase 2 (purL), partial

Sign In for Pricing
View Details
DNAJB6 Antibody (Biotin)
orb46958-01 50 µg

DNAJB6 Antibody (Biotin)

Sign In for Pricing
View Details
DNAJB6 Antibody (Biotin)
orb46958-02 100 µg

DNAJB6 Antibody (Biotin)

Sign In for Pricing
View Details
STF 428-350X500-PHR-C-PP Posters & Wallcharts
223872 1 Card (1 Panel (s) x 1 Pack)

STF 428-350X500-PHR-C-PP Posters & Wallcharts

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Mouse Lambda Light Chain Secondary Antibody [Unconjugated] (Pre-adsorbed)
NBP1-72792-0.5mg 0.5 mg

Rabbit Polyclonal Rabbit anti-Mouse Lambda Light Chain Secondary Antibody [Unconjugated] (Pre-adsorbed)

Sign In for Pricing
View Details
Milpecitinib
HY-168984 1 Each

Milpecitinib

Sign In for Pricing
View Details