Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165)

This Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C14orf165

UniProt

Q86U02

Expression Region

1-117

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQT GVHWCNLGSLQPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADIPOR1
CSB-CL856893HU 10 μg Plasmid + 200 μL Glycerol

ADIPOR1

Sign In for Pricing
View Details
HIGD1C Rabbit pAb, PE-Cy7 conjugated
orb2855701 100 µL

HIGD1C Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 405)
MBS6192020-01 0.1 mL

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 405)

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 405)
MBS6192020-02 5x 0.1 mL

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 405)

Sign In for Pricing
View Details
UFM1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62583R-BF750 100 µL

UFM1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TOMM34 Rabbit Polyclonal Antibody (Fluoro594)
orb3101269 100 µg

TOMM34 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details