Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0051 (RC0051)

This Recombinant Rickettsia conorii Uncharacterized protein RC0051 (RC0051) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0051

UniProt

Q92JL6

Expression Region

1-117

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASSLIKWVCYLGDIAASGFLNSIATALIAVLHDAGDNMFNSKEEKKLVDILTKFYKMI NKQSDITVPVGQDLQRLALLFANLRSVEIKKNNETDFSNFFTTKLPMHNKFFRYDTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quinolones (QNs) ELISA Kit
RDF-E034 96 Tests

Quinolones (QNs) ELISA Kit

Sign In for Pricing
View Details
RAW 264.7 Polarized M1 Macrophage Induction and Identification Kit
XJM004-01 20 Assays

RAW 264.7 Polarized M1 Macrophage Induction and Identification Kit

Sign In for Pricing
View Details
RAW 264.7 Polarized M1 Macrophage Induction and Identification Kit
XJM004-02 100 Assays

RAW 264.7 Polarized M1 Macrophage Induction and Identification Kit

Sign In for Pricing
View Details
Human CRNDE activation kit by CRISPRa
GA118716 1 Kit

Human CRNDE activation kit by CRISPRa

Sign In for Pricing
View Details
Bulk Anti-Human CD307e (509F6) Antibody
ICH1170-25mg 25 mg

Bulk Anti-Human CD307e (509F6) Antibody

Sign In for Pricing
View Details
(R)-N-Desacryloyl N-3-Propionyl Ibrutinib
TRC-D288110-500MG 500 mg

(R)-N-Desacryloyl N-3-Propionyl Ibrutinib

Sign In for Pricing
View Details