Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

P60697

Expression Region

1-118

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp282 Mouse Gene Knockout Kit (CRISPR)
KN519774 1 Kit

Zfp282 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIFY11A Rabbit Polyclonal Antibody
HA500265 100 µL

TIFY11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calprotectin (MRP14) (S100A9) (CPT/1028), 0.2mg/mL
BNUB1028-500 1x 500 µL

Calprotectin (MRP14) (S100A9) (CPT/1028), 0.2mg/mL

Sign In for Pricing
View Details
Slc38a3 Mouse Gene Knockout Kit (CRISPR)
KN516093 1 Kit

Slc38a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CBWD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D4]
TA501609AM 100 µL

CBWD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D4]

Sign In for Pricing
View Details