Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

P60697

Expression Region

1-118

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPC1 (NM_003304) Human Over-expression Lysate
LY418779 100 µg

TRPC1 (NM_003304) Human Over-expression Lysate

Sign In for Pricing
View Details
Catalase (CAT) Rabbit Polyclonal Antibody
AP20209PU-N 100 µg

Catalase (CAT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]
TA501655AM 100 µL

PEPD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D5]

Sign In for Pricing
View Details
CA5A (NM_001739) Human Over-expression Lysate
LY419773 100 µg

CA5A (NM_001739) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PDIA4 Antibody
RC-5350-01 50 μL

Recombinant PDIA4 Antibody

Sign In for Pricing
View Details
Recombinant PDIA4 Antibody
RC-5350-02 100 µL

Recombinant PDIA4 Antibody

Sign In for Pricing
View Details