Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

P60697

Expression Region

1-118

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 594 goat anti-mouse IgG (H+L)
16468-AAT 200 µg

IFluor® 594 goat anti-mouse IgG (H+L)

Sign In for Pricing
View Details
Sodium 4-(2-Ethylhexyl) 2-Sulfobutanedioate Ethyl Ester
TRC-S624085-50MG 50 mg

Sodium 4-(2-Ethylhexyl) 2-Sulfobutanedioate Ethyl Ester

Sign In for Pricing
View Details
3-Carene
TRC-C183450-5G 5 g

3-Carene

Sign In for Pricing
View Details
RUFY2 (NM_001042417) Human Over-expression Lysate
LC420891 20 µg

RUFY2 (NM_001042417) Human Over-expression Lysate

Sign In for Pricing
View Details
Evinacumab Biosimilar - Research Grade
ICH5151-5mg 5 mg

Evinacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Bifenox-d3
TRC-B382902-5MG 5 mg

Bifenox-d3

Sign In for Pricing
View Details