Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase protein I (atpI)

This Recombinant Synechococcus sp. ATP synthase protein I (atpI) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P08443

Expression Region

1-118

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(3-Phenothiazin-10-ylpropyl)-1-piperazineethanol
TRC-P295320-1G 1 g

4-(3-Phenothiazin-10-ylpropyl)-1-piperazineethanol

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), 0.2mg/mL
BNUB1497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), 0.2mg/mL

Sign In for Pricing
View Details
Human Osteocrin (OSTN) activation kit by CRISPRa
GA117601 1 Kit

Human Osteocrin (OSTN) activation kit by CRISPRa

Sign In for Pricing
View Details
3-Amino-6-nitro-4-phenyl-2(H)-quinolinone
TRC-A618755-5MG 5 mg

3-Amino-6-nitro-4-phenyl-2(H)-quinolinone

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF568 conjugate, 0.1mg/mL
BNC680252-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details