Recombinant Synechococcus sp. ATP synthase protein I (atpI)
This Recombinant Synechococcus sp. ATP synthase protein I (atpI) spans the amino acid sequence from region 1-118.
Product Specifications
Product Name Alternative
ATP synthase protein I
UniProt
P08443
Expression Region
1-118
Origin
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680966-500 1x 500 µL
Hepatocyte Specific (HepPar1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680195-100 1x 100 µL
CD66 (CEA) (C66/195), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 