Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A5IRC4

Expression Region

1-118

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Mannose-UL-13C6
sc-489398 10 mg

D-Mannose-UL-13C6

Sign In for Pricing
View Details
KLHDC10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25763061 1.0 µg DNA

KLHDC10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SFTPB Rabbit Polyclonal Antibody
orb631122-01 50 µg

SFTPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFTPB Rabbit Polyclonal Antibody
orb631122-02 100 µg

SFTPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C9orf96 (STKLD1) (NM_153710) Human Over-expression Lysate
LH14930V 100 µg

C9orf96 (STKLD1) (NM_153710) Human Over-expression Lysate

Sign In for Pricing
View Details
Leiomodin 3 (LMOD3) (NM_198271) Human Recombinant Protein
TP323251M 100 µg

Leiomodin 3 (LMOD3) (NM_198271) Human Recombinant Protein

Sign In for Pricing
View Details