Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A5IRC4

Expression Region

1-118

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVALB Antibody
E30AC1944 100 µL

PVALB Antibody

Sign In for Pricing
View Details
OR6C70 Lentiviral Activation Particles (h2)
sc-416572-LAC-2 200 µL

OR6C70 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Med24 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4805004 1.0 µg DNA

Med24 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FOLR2 (N-term) Rabbit pAb
E2613015 100 µL

FOLR2 (N-term) Rabbit pAb

Sign In for Pricing
View Details
THIOM discontinued
543092-01 30ul

THIOM discontinued

Sign In for Pricing
View Details
THIOM discontinued
543092-02 100 µL

THIOM discontinued

Sign In for Pricing
View Details