Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6QFF6

Expression Region

1-118

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Pro 300V Power Supply
MINI-300 1 Unit

Mini Pro 300V Power Supply

Sign In for Pricing
View Details
2C-C-NBOMe Hydrochloride
TRC-C025000-10MG 10 mg

2C-C-NBOMe Hydrochloride

Sign In for Pricing
View Details
Small Cell Lung Cancer (SCLC) (MOC-52), 0.2mg/mL
BNUB0329-500 1x 500 µL

Small Cell Lung Cancer (SCLC) (MOC-52), 0.2mg/mL

Sign In for Pricing
View Details
ENSA (NM_207168) Human Recombinant Protein
TP309655 20 µg

ENSA (NM_207168) Human Recombinant Protein

Sign In for Pricing
View Details
Human SPATA31A5 activation kit by CRISPRa
GA118893 1 Kit

Human SPATA31A5 activation kit by CRISPRa

Sign In for Pricing
View Details
IRAKM Antibody
KC-28091-01 50 μL

IRAKM Antibody

Sign In for Pricing
View Details