Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6QFF6

Expression Region

1-118

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]
TA810894AM 100 µL

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]

Sign In for Pricing
View Details
VISTA Recombinant Rabbit Monoclonal Antibody [PSH0-65]
HA721453 100 µL

VISTA Recombinant Rabbit Monoclonal Antibody [PSH0-65]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-, 1mL 40nm
GP-4601-40 1 mL

Colloidal Gold Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-, 1mL 40nm

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF647 conjugate, 0.1mg/mL
BNC473788-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SRC Rabbit Monoclonal Antibody
TA422480 100 µL

SRC Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GC1q R Recombinant Mouse Monoclonal Antibody [A8F5-R]
HA601198 100 µL

GC1q R Recombinant Mouse Monoclonal Antibody [A8F5-R]

Sign In for Pricing
View Details