Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6QFF6

Expression Region

1-118

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6D (NM_003695) Human Recombinant Protein
TP762530 50 µg

LY6D (NM_003695) Human Recombinant Protein

Sign In for Pricing
View Details
Squalane
TRC-S683750-2.5G 2.5 g

Squalane

Sign In for Pricing
View Details
RPL24 Rabbit Polyclonal Antibody
TA381047 100 µL

RPL24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UCP1 Recombinant Rabbit monoclonal Antibody
HA751580 100 µL

UCP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Antithrombin (AT) ELISA Kit
RD-AT-Mu-01 96 Tests

Mouse Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details
Mouse Antithrombin (AT) ELISA Kit
RD-AT-Mu-02 48 Tests

Mouse Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details