Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A7X0F5

Expression Region

1-118

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1471 Protein Vector (Rat) (pPB-C-His)
PV288286 500 ng

Olr1471 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
mmu-miR-598 Primers
MPM00593 150 µL - 10 µM

mmu-miR-598 Primers

Sign In for Pricing
View Details
Difluprednate
C09906-50mg 50 mg

Difluprednate

Sign In for Pricing
View Details
Methyl Stearate
C11319 25 mg

Methyl Stearate

Sign In for Pricing
View Details
CD8 (Suppressor/Cytotoxic T cell) (PE)
C2259-11D 120 Tests

CD8 (Suppressor/Cytotoxic T cell) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal beta 2-Microglobulin Antibody (SPM617) [Alexa Fluor 532]
NBP2-47703AF532 0.1 mL

Mouse Monoclonal beta 2-Microglobulin Antibody (SPM617) [Alexa Fluor 532]

Sign In for Pricing
View Details