Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A8Z053

Expression Region

1-118

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CXCL2/MIP-2 Protein
PKSM040996-01 20 µg

Recombinant Mouse CXCL2/MIP-2 Protein

Sign In for Pricing
View Details
Recombinant Mouse CXCL2/MIP-2 Protein
PKSM040996-02 100 µg

Recombinant Mouse CXCL2/MIP-2 Protein

Sign In for Pricing
View Details
NextPette™ variable volume pipette 2 to 20ul
P7700-20 1 Each

NextPette™ variable volume pipette 2 to 20ul

Sign In for Pricing
View Details
Recombinant Human IRAK4/IRAK-4 Protein (His Tag)
PKSH030387-01 50 µg

Recombinant Human IRAK4/IRAK-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IRAK4/IRAK-4 Protein (His Tag)
PKSH030387-02 500 µg

Recombinant Human IRAK4/IRAK-4 Protein (His Tag)

Sign In for Pricing
View Details
MPO Antibody
KC-2763-01 50 μL

MPO Antibody

Sign In for Pricing
View Details