Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A8Z053

Expression Region

1-118

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-Capsaicin
TRC-C175690-10MG 10 mg

cis-Capsaicin

Sign In for Pricing
View Details
HDAC1 Antibody
8C0221-AAT 50 µg

HDAC1 Antibody

Sign In for Pricing
View Details
SR140 (U2SURP) (NM_001080415) Human Over-expression Lysate
LY421632 100 µg

SR140 (U2SURP) (NM_001080415) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPP) (NM_001632) Human Recombinant Protein
TP310504 20 µg

Alkaline Phosphatase (ALPP) (NM_001632) Human Recombinant Protein

Sign In for Pricing
View Details
4-Acetyl-L-phenylalanine Hydrochloride
TRC-A187540-250MG 250 mg

4-Acetyl-L-phenylalanine Hydrochloride

Sign In for Pricing
View Details
Recombinant XPD Antibody
RC-5498-01 50 μL

Recombinant XPD Antibody

Sign In for Pricing
View Details