Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A8Z053

Expression Region

1-118

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA8CP Antibody
KC-43639-01 50 μL

GOLGA8CP Antibody

Sign In for Pricing
View Details
GOLGA8CP Antibody
KC-43639-02 100 µL

GOLGA8CP Antibody

Sign In for Pricing
View Details
GOLGA8CP Antibody
KC-43639-03 1 mL

GOLGA8CP Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®597R Antibody Labeling Kit, 1x (50-100ug) labeling
#92463 1 Kit

Mix-n-StainTM CF®597R Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
4930550C14Rik Mouse Gene Knockout Kit (CRISPR)
KN500397 1 Kit

4930550C14Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac N-tert-Butoxycarbonyl Viloxazine
TRC-B690510-10MG 10 mg

rac N-tert-Butoxycarbonyl Viloxazine

Sign In for Pricing
View Details