Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0295 protein BCG9842_B4782 (BCG9842_B4782)

This Recombinant Bacillus cereus UPF0295 protein BCG9842_B4782 (BCG9842_B4782) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0295 protein BCG9842_B4782

UniProt

B7IWR6

Expression Region

1-118

Origin

Bacillus cereus (strain G9842)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIVMTTFMMVGFLAVIASTVVYFW IGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNKKSYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF405S conjugate, 0.1mg/mL
BNC041628-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL
BNC041786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473), CF647 conjugate, 0.1mg/mL
BNC470473-100 1x 100 µL

CD5 (C5/473), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF594 conjugate, 0.1mg/mL
BNC940717-100 1x 100 µL

CD1a (O10 + C1A/711), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details