Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557)

This Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0295 protein BCA_0557

UniProt

C1EWH3

Expression Region

1-118

Origin

Bacillus cereus (strain 03BB102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin light chain kinase (MYLK) (N-term) Rabbit Polyclonal Antibody
AP14867PU-N 400 µL

Myosin light chain kinase (MYLK) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
REX1BD (NM_001100419) Human Over-expression Lysate
LC420258 20 µg

REX1BD (NM_001100419) Human Over-expression Lysate

Sign In for Pricing
View Details
Primer Panel
HPP6015A 3x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker), CF488A conjugate, 0.1mg/mL
BNC881657-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Noggin (NOG) ELISA Kit
RD-NOG-Ra-01 96 Tests

Rat Noggin (NOG) ELISA Kit

Sign In for Pricing
View Details
Rat Noggin (NOG) ELISA Kit
RD-NOG-Ra-02 48 Tests

Rat Noggin (NOG) ELISA Kit

Sign In for Pricing
View Details