Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557)

This Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0295 protein BCA_0557

UniProt

C1EWH3

Expression Region

1-118

Origin

Bacillus cereus (strain 03BB102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Recombinant Mouse Monoclonal Antibody [G3-B11-R]
HA601309 100 µL

STAT1 Recombinant Mouse Monoclonal Antibody [G3-B11-R]

Sign In for Pricing
View Details
Human PDE4A activation kit by CRISPRa
GA103438 1 Kit

Human PDE4A activation kit by CRISPRa

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL
BNC682045-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cmtr2 Mouse Gene Knockout Kit (CRISPR)
KN503531 1 Kit

Cmtr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADAM15 Recombinant Rabbit Monoclonal Antibody [JE39-01]
HA722402 100 µL

ADAM15 Recombinant Rabbit Monoclonal Antibody [JE39-01]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS707129 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details