Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557)

This Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0295 protein BCA_0557

UniProt

C1EWH3

Expression Region

1-118

Origin

Bacillus cereus (strain 03BB102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RPSA Antibody
RC-4448-01 50 μL

Recombinant RPSA Antibody

Sign In for Pricing
View Details
Recombinant RPSA Antibody
RC-4448-02 100 µL

Recombinant RPSA Antibody

Sign In for Pricing
View Details
Recombinant RPSA Antibody
RC-4448-03 1 mL

Recombinant RPSA Antibody

Sign In for Pricing
View Details
TENR (ADAD1) Human qPCR Primer Pair (NM_139243)
HP217146 200 Reactions

TENR (ADAD1) Human qPCR Primer Pair (NM_139243)

Sign In for Pricing
View Details
GRK2 Human Knockdown Lysate
LY300349 100 µg

GRK2 Human Knockdown Lysate

Sign In for Pricing
View Details
L-Carnitine Benzyl Ester Chloride
TRC-C184130-1MG 1 mg

L-Carnitine Benzyl Ester Chloride

Sign In for Pricing
View Details