Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation protein yjcA (yjcA)

This Recombinant Bacillus subtilis Sporulation protein yjcA (yjcA) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Sporulation protein yjcA

UniProt

O31623

Expression Region

1-118

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVINGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVR AFIGELLSCYWCTGVWCAGFLILCQAVIPQAAQWLILLLAIAGLAGIIETLVSKWLQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Ul16 Binding Protein 2 ELISA Kit
MBS036338 Inquire

Goose Ul16 Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
TBX1 Recombinant Rabbit mAb
E43S47875 100 µL

TBX1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
FGF17 Antibody - middle region
ARP76800_P050-25UL 25 µL

FGF17 Antibody - middle region

Sign In for Pricing
View Details
Mouse Hcrt/Orexin ELISA Kit
E0662Mo 96 Tests

Mouse Hcrt/Orexin ELISA Kit

Sign In for Pricing
View Details
C12orf23 (TMEM263) Human qPCR Template Standard (NM_152261)
HK201209 1 Kit

C12orf23 (TMEM263) Human qPCR Template Standard (NM_152261)

Sign In for Pricing
View Details
TCEAL4 Polyclonal Antibody
E-AB-52332-01 20 µL

TCEAL4 Polyclonal Antibody

Sign In for Pricing
View Details