Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation protein yjcA (yjcA)

This Recombinant Bacillus subtilis Sporulation protein yjcA (yjcA) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Sporulation protein yjcA

UniProt

O31623

Expression Region

1-118

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVINGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVR AFIGELLSCYWCTGVWCAGFLILCQAVIPQAAQWLILLLAIAGLAGIIETLVSKWLQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LEXM shRNA (UAS) - Lentiviral human LEXM shRNA (UAS) plasmid
GTR15314230 1 Vial

Lentiviral human LEXM shRNA (UAS) - Lentiviral human LEXM shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Mouse VTCN1/B7-H4 Protein, C-His
E55P7347 50 µg

Recombinant Mouse VTCN1/B7-H4 Protein, C-His

Sign In for Pricing
View Details
C1QBP Antibody
E91883 100 µL

C1QBP Antibody

Sign In for Pricing
View Details
GRN Protein Vector (Rat) (pPM-C-HA)
PV271668 500 ng

GRN Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
FimH Polyclonal Antibody
orb3149022-01 50 µg

FimH Polyclonal Antibody

Sign In for Pricing
View Details
FimH Polyclonal Antibody
orb3149022-02 100 µg

FimH Polyclonal Antibody

Sign In for Pricing
View Details