Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliobacterium modesticaldum NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Heliobacterium modesticaldum NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

B0TH77

Expression Region

1-118

Origin

Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEYLGISLFLAAGLIIPFLAFAVSRLLQTRKNSLVKGEPYECGMETIGDTWIQFKSNY FLYALVFVAFDVETVFLYPWAVKFQQLGTFAIVEMFIFITILVVGFWYAWKEGALEWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF647 conjugate, 0.1mg/mL
BNC471175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-500 1x 500 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (DO-7), CF647 conjugate, 0.1mg/mL
BNC470513-100 1x 100 µL

P53 (DO-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details