Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 (mnhG1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 (mnhG1) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

Q2G2H9

Expression Region

1-118

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEG10 (NM_001040152) Human Over-expression Lysate
LC421697 20 µg

PEG10 (NM_001040152) Human Over-expression Lysate

Sign In for Pricing
View Details
Growth Arrest Specific Protein 7 (GAS7) (NM_201433) Human Over-expression Lysate
LC404415 20 µg

Growth Arrest Specific Protein 7 (GAS7) (NM_201433) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB506265 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
ACOX3 Human Gene Knockout Kit (CRISPR)
KN422515 1 Kit

ACOX3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C17orf67 Human Gene Knockout Kit (CRISPR)
KN417843 1 Kit

C17orf67 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803909 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details