Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 (mnhG1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 (mnhG1) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

Q2G2H9

Expression Region

1-118

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), 1mg/mL
BNUM1731-50 1x 50 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), 1mg/mL

Sign In for Pricing
View Details
Human ZNF784 activation kit by CRISPRa
GA115632 1 Kit

Human ZNF784 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin-4 Antibody
KC-1083-01 50 μL

Cytokeratin-4 Antibody

Sign In for Pricing
View Details
Cytokeratin-4 Antibody
KC-1083-02 100 µL

Cytokeratin-4 Antibody

Sign In for Pricing
View Details
Cytokeratin-4 Antibody
KC-1083-03 1 mL

Cytokeratin-4 Antibody

Sign In for Pricing
View Details
Dioctylhexylphosphine oxide
TRC-D145870-50MG 50 mg

Dioctylhexylphosphine oxide

Sign In for Pricing
View Details